Thrombopoietin Antikörper

Produktnummer ABIN634773

Dieses Anti-Thrombopoietin-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Thrombopoietin in WB. Geeignet für Human.

Kurzübersicht für Thrombopoietin Antikörper (ABIN634773)

Target: Thrombopoietin (THPO)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Thrombopoietin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Thrombopoietin Antikörper

Aufreinigung: Affinity purified

Immunogen: Thrombopoietin antibody was raised using a synthetic peptide corresponding to a region with amino acids NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Thrombopoietin Blocking Peptide, (ABIN5616592), is also available for use as a blocking control in assays to test for specificity of this Thrombopoietin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THPO antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Thrombopoietin

Target: Thrombopoietin (THPO)

Andere Bezeichnung: Thrombopoietin

Hintergrund: Megakaryocytopoiesis is the cellular development process that leads to platelet production. THPO is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. THPO is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene.Megakaryocytopoiesis is the cellular development process that leads to platelet production.

Molekulargewicht: 35 kDa (MW of target protein)

Pathways: JAK-STAT Signalweg, Hormone Activity